DPCstruct | MC6417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 308 ± 44 aa |
| Standard deviation of domain lengths | 44.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9LSZ0 | 1-219 | MSIGRERGTATNELARFFYQFKQFPLSFIMRIWQRGIAQNTPQEKFVYFAKMFAYTTVMGGIVAQVQNLTNGKDFDDPTTLDFYMKS… |
| A0A258I1R2 | 117-428 | TQTMRWVYGMETLATYTEAAGKSFADLAPKLRGALERYGMGSEDWDKLRSAPMERDRGADWIAPHKLDDQELGSRFMEMVHTETDIA… |
| A0A2S3WFB8 | 497-854 | None |
| A0A522C8X0 | 1-336 | None |
| A0A244C5L1 | 28-363 | None |
| A0A0N1EN20 | 1-313 | None |
| A0A853QVL2 | 298-642 | None |
| N9JLX8 | 190-526 | None |
| A0A1V5QRL1 | 596-872 | None |
| A0A7Z1ZEL0 | 807-1048 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.