DPCstruct | MC64169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 373 ± 40 aa |
| Standard deviation of domain lengths | 40.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.40 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF01937- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1KUE8 | 1-380 | MRMAEEGDHRSMDILVSDIYGGRAHKLGLPNDLIAGSFGKCADAEYVEAVKKNSHYRSDVLRSLLLMISNSIGQIAVLYASTLNANR… |
| A0A2D4HK57 | 105-462 | MLVKDIYGGAYQTLGLSGNLIASSFGKSATVDKDFSKEDMAKSLLHMISNDIGQLACLHAKLHNLDKIYFGGFFIRGHPVTMRTITY… |
| A0A182QX72 | 100-427 | None |
| A0A804QE55 | 177-580 | None |
| A0A4U6W9G9 | 189-595 | None |
| A0A2J8K8V7 | 4-301 | None |
| A0A1I7W718 | 7-410 | None |
| A0A6A3CC70 | 656-968 | None |
| A0A1J6J888 | 2-355 | None |
| A0A7I8VBT9 | 403-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.