DPCstruct | MC64167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 37.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812BU54 | 36-239 | NNTKIERAEQKRAAPSTSRATDEPRSKKRKSADIPKVECFFCEEEDVISNLQEGMTERLNENLNQCARTLNDGKLLAKLSGGDIVAL… |
| A0A7J7AFN5 | 73-272 | VSENPQVAEVSNVAVEADTVDQDVTQSQNITICFFCEKSRKKIKGRENKLALFTPAGRLTIKNLAIRSQDSNMVNKLENLSSEQECF… |
| C4A046 | 2-215 | None |
| A0A1A7XPK8 | 70-309 | None |
| A0A2G8L5S4 | 90-313 | None |
| A0A4Y2TRS4 | 1-190 | None |
| A0A6S7HK46 | 57-257 | None |
| A0A6S7I4D1 | 67-308 | None |
| A0A6S7H155 | 3-227 | None |
| A0A483AAW5 | 6-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.