DPCstruct | MC64164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 576 ± 87 aa |
| Standard deviation of domain lengths | 87.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 66.12 |
| Assigned Pfam label(s) | CL0063- PF20886- CL0304- CL0010- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812BLF6 | 91-649 | LSVENVQMYDMHVISISPEKKNCLDLTSPSCLIADDRQLKKLQNPSLAILSLRKETAQLQKRYLCLEFGCIIWGKMSGYRPWPGLTI… |
| A0A667YA29 | 5-495 | FSAFARCFCANSFAKLTTYRDAIFKSLQVRMKFPDCSGDREEQLRLMLDWAFGGFQPSGPDGHKPPPTHAFCLCCGTEDIEIFHPLF… |
| A0A1I8IPI0 | 7-535 | None |
| A0A1Q9E6I6 | 293-830 | None |
| A0A674HSD2 | 532-1252 | None |
| A0A3B4HCP0 | 460-998 | None |
| A0A7S2LD16 | 209-955 | None |
| A0A834JKS4 | 480-1101 | None |
| A0A6P9A0T4 | 1-446 | None |
| A0A6J2A7V8 | 58-763 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.