DPCstruct | MC64161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 112 ± 22 aa |
| Standard deviation of domain lengths | 21.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7KRJ4 | 4-113 | SPNFQKWGSADDLKCAEWLFSRKCEVFKELGLQEPKEPNFTEWANDVRLMVSQDGRTHKEICQFYKRVSHDEFWKKNVQCPRTLRTQ… |
| A0A380X7V2 | 4-89 | AQWIFGLILKLNPNTKTPSFDSWANEIRLMRERDGRTHREICGLFQWANQDSFWKTNILSPAKLREKWDPLTVKKNNTKPQRKTVS |
| A0A517LU68 | 4-100 | None |
| A0A1U9YU90 | 2-132 | None |
| A0A7U4R7K0 | 2-85 | None |
| A0A377BQE0 | 80-189 | None |
| C3GCC0 | 2-88 | None |
| A0A7C3GW76 | 8-107 | None |
| A0A376U721 | 1-94 | None |
| A0A2U2AUI2 | 49-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.