DPCstruct | MC6416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 670 ± 105 aa |
| Standard deviation of domain lengths | 105.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 14.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3V444 | 36-672 | FTLGQAFRQGQVPAGKFVGSSLAGLQVTPKNYWPDGSLKFAVLSGRATLAANTAQVCTLNASGAAGTGAALTTAALRATNIAAAVDA… |
| A0A1I7GEH2 | 289-951 | VTFGQIFVKGQLLPKEGLAGKLADGSAVALQMDVKATHDDGSVRHAIVSGVVPKLAAGQTQVLTLAKSGPATTPSTVTPQALLSAGL… |
| A0A7Y8J2G5 | 20-652 | None |
| A0A1H4CLW7 | 231-1038 | None |
| A0A7G1QBH2 | 405-1085 | None |
| A0A1Y5TPX4 | 306-938 | None |
| A0A495RUC1 | 30-580 | None |
| A0A1Y5TQK1 | 77-749 | None |
| A0A3D4ZU74 | 35-921 | None |
| A0A1V1P8U5 | 149-847 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.