DPCstruct | MC64158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.47 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF21157- CL0167- CL0382- PF21173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2IXB3 | 19-134 | TPEELAEVRGLLEIEIEVRKAELRENEDEVAERLTDPVEGAGDDPADVGAKAFQREHDLALAYNTRDLLAMSERAIERMDAGTYGAC… |
| A0A2D0IGD2 | 5-101 | LAQIELALVESVSATATVMLDQSSVGRLSRMDALQQQALAQEMRGRLQLSKRKLEAAMVRLDAGRYGLCCDCGEPMEADRLDRDPAA… |
| A0A7X0LT08 | 173-283 | None |
| T0D0U9 | 2-61 | None |
| A0A0H5D3X8 | 30-106 | None |
| A0A4R8CT56 | 7-125 | None |
| D9SKL3 | 6-126 | None |
| A0A838E504 | 8-121 | None |
| D7N2S0 | 4-97 | None |
| A0A3B9PUK0 | 51-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.