DPCstruct | MC64153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 380 ± 80 aa |
| Standard deviation of domain lengths | 79.61 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 92.28 |
| Assigned Pfam label(s) | CL0268- PF20250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231V9B0 | 69-389 | VQILSGKIQVTDPSPEGKYASIIADDPNIEVYINGKMTTGIAIVTEKDRIDLKAKSIAPSTEIKVDISSDKLKATLTVEKKTGRKYF… |
| A0A1Q9JDV3 | 4-347 | KIDIKISKNAMAVTVSILPSGDENITAALLRNELGLRGIVAGIDERMLREIEERGIYKKVYTVASGEYATRGKAGYYEFLFDKDLKE… |
| A0A1Y6CDV9 | 281-661 | None |
| A0A7Y0Q2N9 | 29-411 | None |
| A0A2H0PIL6 | 744-1216 | None |
| A0A1G0ZAJ4 | 138-505 | None |
| A0A661PA59 | 3-387 | None |
| A0A1F6L8L0 | 637-1068 | None |
| A0A2E8K655 | 81-301 | None |
| A0A6I7QX26 | 504-959 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.