DPCstruct | MC6415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8N3E3 | 13-106 | DISPEAIFWRPLLWFCKEHKKSSDDLDEFNYVTYDIGNRLRFELRFYNGHPAGTTTFYLSREFGNSDDIQHAINRAIDELHLPKSAI… |
| A0A094IQ10 | 6-106 | KFTGWPSRDCYPLMRLSMEPEELSDKFGIEFVDGRDDLDHFLAGHIFDEIIGFVVFIRHRNAPQSGTPVYVDSQVSSNKSIERITKV… |
| A0A7W5FJM1 | 11-103 | None |
| A4YYE6 | 18-126 | None |
| A0A2T1C7M2 | 8-111 | None |
| A0A7W7CH28 | 6-110 | None |
| A0A8A6H7Q2 | 56-143 | None |
| J6UHD4 | 12-127 | None |
| A0A1I6FBF4 | 1-99 | None |
| A0A2D2DE41 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.