DPCstruct | MC64149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0U6E8 | 2-149 | SIEVWPFLVSRNRHLDYRTVVAPDFICEAKTGNLLARVTTGDLTDSGKGFIRQIFGSKVGDFTIVYRILKARQKYINFQEGDEILKD… |
| A0A4R5BA30 | 2-147 | AVPFLLARRYAVGERFILGPDEDDEDLRRAVSKSGGREFPADPRYRVVPYGPGLHAIYREFELTAADLGVQGPVRDEHGRSILAIEG… |
| A0A372GEE8 | 1-139 | None |
| A0A1Q7W345 | 2-147 | None |
| C6W845 | 5-181 | None |
| A0A7W0CNK2 | 1-160 | None |
| A0A0H5D1E6 | 3-144 | None |
| A0A3N1D893 | 5-126 | None |
| A0A1H0N2Q6 | 3-150 | None |
| A0A7K2R310 | 12-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.