DPCstruct | MC64146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 199 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0PE12 | 1-214 | MKQQREVITICDICEKPYKSNQISPFICDDCLKKSNNFANDASLYCSECMSEINKGEPYHLDDSRLVYCDTCFSYTGSSSILPHRHK… |
| N1Z787 | 1-249 | MREVFYCSQCGEELTEENVYFMEDEVYCLDCFEELTDTCAECGERIYISENEGTEDTPLCSQCYYHYYTRCNHCDELIMLDNAYYEQ… |
| A0A2D7TN32 | 116-308 | None |
| A0A2T2ZBY1 | 2-175 | None |
| A0A7W5D317 | 51-239 | None |
| R7L1H9 | 2-199 | None |
| A0A225M1P6 | 354-534 | None |
| A0A497AZX7 | 102-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.