DPCstruct | MC6413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 5.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 70.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9FAC3 | 13-66 | AFERSSKRRKGYPSETKVKRGARVVHGEKELVEKLGRNDLCPCGSGRCFQALLP |
| A0A4D7DEA0 | 23-78 | YPAFERTSKRRKGYPSETRVKRGLRFVHGDKELVEKLGRNDPCPCNSGLRFQAVLS |
| A0A6I4TLN3 | 1-60 | None |
| A0A2R7JPC4 | 5-61 | None |
| A0A7T8MKQ3 | 1-51 | None |
| A0A3F2U075 | 41-96 | None |
| A0A410VDU0 | 65-115 | None |
| A0A4Q3DU19 | 33-92 | None |
| D2R5Y8 | 1-47 | None |
| L0DMS6 | 12-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.