DPCstruct | MC64120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 262 ± 79 aa |
| Standard deviation of domain lengths | 79.09 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6SQA8 | 2-280 | QKKGQITIFIILGIVLIVVSGIFFYINKSSAESESAVSVAKSSDSTDSDIVQTYAEACLKMVTEEALFNKIGLQGGYINPVNVPSEG… |
| A0A256YAR3 | 1-212 | MNKRAQLTIFIVIAVIVIALALIAWQFWPRIRDAFMSEEQARAFLSTQVRPLKDSISFCIKETAKDILEEQGRHAGYYQLIDLHGAV… |
| A0A842QLV8 | 2-287 | None |
| A0A842TZK8 | 1-362 | None |
| A0A842UDT0 | 1-226 | None |
| A0A842UUE8 | 156-307 | None |
| A0A7C4S6H0 | 1-224 | None |
| A0A2H9PSX3 | 1-194 | None |
| A0A5E4JRD7 | 6-252 | None |
| A0A532T508 | 2-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.