DPCstruct | MC6412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D7DA65 | 4-69 | LPEGFVAHSGGPCPVAPDTMVTVVFRDGQVVERERAKFWSGPGEDWWRWQSHNHDNDIIAYKVENP |
| A0A5C8J0V6 | 10-64 | WIKWHGGECPVPPDTLVEVRLRIGERGKPVAAGAYDWPHSDEDGDIVEYRIVPEQ |
| A0A7Z1ZDP0 | 14-76 | None |
| A0A2D7XBX7 | 67-127 | None |
| A0A2E6JZ26 | 121-177 | None |
| A0A1I3FVE1 | 68-135 | None |
| A0A7Y7SSS1 | 101-157 | None |
| A0A7X2IEN7 | 74-135 | None |
| A0A4Q3Y6L9 | 2-77 | None |
| A0A1Z3U571 | 73-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.