DPCstruct | MC64099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 198 |
|---|---|
| Mean domain length (aa) | 215 ± 35 aa |
| Standard deviation of domain lengths | 35.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 69.01 |
| Assigned Pfam label(s) | PF19426- CL0123- PF20878- CL0010- PF01448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177B3H7 | 18-244 | CSESTDTEYNPTKDDLMKTFDIQIDGENDAFVKDEEKTLLMDVRVGDQYQVMLPPLMSRQEYSVINDSKRVAQCVWTPPDNNNAENE… |
| T0NPW5 | 184-370 | KGEIRVGNRYQADITDLLKEGEEDGRDQSKLETKVWEAHNPLTDKQVDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDIT… |
| M1VAY5 | 504-758 | None |
| A0A0D8XGD2 | 192-397 | None |
| A0A1S8VY16 | 298-511 | None |
| A0A7S1UJW4 | 16-209 | None |
| A0A158R687 | 161-356 | None |
| A0A7M3RR53 | 322-530 | None |
| A0A7E4WAA7 | 104-338 | None |
| A0A7R9A5R8 | 4-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.