DPCstruct | MC64097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 150 ± 30 aa |
| Standard deviation of domain lengths | 29.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | PF00351- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177B263 | 252-397 | CTQYIRHSKYPFYTPEPDCCHELLGHVPMLMDKKIADFSQMLGLASIGVSDEIVDDIATCYFFTIEFGLCKENEITKVYGAGLLSCK… |
| A0A2E2UFJ3 | 91-240 | LSKKRFTTTCWLRSLEEIDYLEEPDMFHDIFAHVPLLSNKSYTKFFYELGNIGVSVINNPDKLLRLQRLYWFTIEFGLIKSKELDKI… |
| A0A6P4E647 | 148-338 | None |
| A0A3P7FRZ1 | 2-126 | None |
| A0A3M8FZ50 | 130-271 | None |
| S7J6W4 | 75-237 | None |
| A0A7T9DFV9 | 116-294 | None |
| A0A4Y2LQ77 | 123-247 | None |
| A0A7D9LZL5 | 3-124 | None |
| A0A820ZBR3 | 258-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.