DPCstruct | MC64096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 143 ± 27 aa |
| Standard deviation of domain lengths | 26.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177B0I1 | 42-204 | DIEDCQYQYNQTLKIVDSKSLNNEQVLMIQFGEFLLKKMMIKITEYEEFGVYLIKKDYRNILSNKIKIAAASEIPNNGYHSNCFRYS… |
| A0A497SMY1 | 114-233 | RESQERLSGVEVILDERLGPQELAHLNLARAIAHDICYGLEGVSAAVIPPASDRTRTAGMYDRNLKMIYIGLDQLSRARTTIDTVIH… |
| A0A1B0GT42 | 1361-1532 | None |
| P75163 | 68-177 | None |
| A0A3M0IT01 | 840-1000 | None |
| A0A2M7MG14 | 845-963 | None |
| R7J1M1 | 16-135 | None |
| A0A6J2QZE3 | 392-560 | None |
| A0A1Q9MYK3 | 235-349 | None |
| A0A177B041 | 267-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.