DPCstruct | MC6409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 414 ± 43 aa |
| Standard deviation of domain lengths | 42.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2V3T8 | 14-420 | SPDASRKQSMISEDGFLSQPVSRGVLKAGEKPKKCEDKPWVRINHTTKGETTRTARINQHAEEGHRYKTKKLPYGDWESTHYTFDYS… |
| A0A4U7AUS0 | 31-428 | MELTTPEALSIFSNEDIIMMHGGWDALRSLQTDKQMPDIPSEIMDSWVRDPLNASDPLEYAVPLYTPGPSSSLIRTREAAFTDDNDE… |
| A0A3S5CX08 | 240-701 | None |
| A0A6A7A4S5 | 1-460 | None |
| A0A2T3B292 | 21-421 | None |
| A0A2C5XW38 | 138-579 | None |
| A0A179H3T2 | 186-656 | None |
| A0A0C3DVQ9 | 37-467 | None |
| M1W0G7 | 29-498 | None |
| A0A0S6XQJ7 | 1-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.