DPCstruct | MC64089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 785 ± 87 aa |
| Standard deviation of domain lengths | 87.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YAV1 | 12-746 | EGILIKKRYAVFNEDGTLAELKGFEIKRRGELKLIKVFQAEVFDKFLHGSTLEECYAAVASVANRWLDLLDNQGIDISDSELLGFIS… |
| A0A287F4X9 | 1-772 | MSTLLLQDMVVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGAKIIQNARLLVDKIGRPLELDTDGIWCVLPGSFPEN… |
| A0A452YAU9 | 1-735 | None |
| A0A7N4NHU2 | 417-1072 | None |
| A0A5K4EYZ8 | 718-1709 | None |
| A0A183H6I0 | 1-728 | None |
| A0A820TFL3 | 106-959 | None |
| A0A7I8ISH0 | 1-698 | None |
| A0A7J8PZ16 | 208-936 | None |
| A0A7S3EEA9 | 2-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.