DPCstruct | MC64087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1QWC8 | 153-230 | MSYHKFNESQRELVVLKRLKEGEIVALITDAGTPGISDPGMDLAKLCVDEHIPVVPIPGPCALVSALSASGLPTDEFT |
| A0A1Y0VLV3 | 1-82 | MSFHEHNTQQRIPTILKMLEDGQQIAQVSDAGMPSISDPGQELVKAAVSQHLNVVPLPGSNAGITALIASGLVPQPFTFYGF |
| A0A0R0K914 | 1-79 | None |
| A0A212KV44 | 31-138 | None |
| A0A4S4DKZ5 | 137-214 | None |
| A0A4S4EMC1 | 58-136 | None |
| A0A1S3E7W2 | 109-187 | None |
| A0A0R0K2Y8 | 1-79 | None |
| A0A6A5KUN8 | 16-115 | None |
| A0A7J7HUL0 | 137-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.