DPCstruct | MC64085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 216 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452Y5L3 | 1-210 | DFCGEMQECPVGTYKNITGSSNSLCSPCPAYELPHRAIYMHIRGGVAETPCPYKCVSDRYRMPHCFTALEELIYTFGGPWFFGLLLS… |
| G0R539 | 194-447 | CLPGYEPYKGLFQCKKCSLGKYKKSVGRDMCLDCENENKERLEFVKEDFLQKRECSYVCKSGFKSIKRNNDKNIVCLENFEYFLAIM… |
| A0A453E6Z2 | 411-628 | None |
| A0A287KCP5 | 662-880 | None |
| A0A6P6SHP1 | 461-642 | None |
| A0A453AA17 | 131-346 | None |
| A0A453A9X6 | 504-730 | None |
| A0A812J8X2 | 325-548 | None |
| A0A7J9H879 | 1-201 | None |
| A0A6A3CDW8 | 293-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.