DPCstruct | MC6408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 24.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U7ARL5 | 61-217 | PAFDSDPRTNVEPSLSAITSRKAGKLPSVHGDTLATPRATVARVGVKRPTAENEWWSKTDQEWRGMSDKQKKAFDHIRKIMEEGYGE… |
| A0A443HSD0 | 21-209 | SSDSPSPEPLPVESSDSPSPEALFVESSGSSSTGSLSVDFHGPSRSRENYDRSQVADQPRLPWEWNPRGKTTELYTHTAVGKWWFHG… |
| A0A6A6ZU25 | 105-279 | None |
| A0A1L7XBF5 | 1-192 | None |
| A0A517LEY8 | 99-276 | None |
| A0A5N6U882 | 190-384 | None |
| A0A6A6ARN7 | 31-186 | None |
| A0A7C8IE86 | 136-344 | None |
| A0A1S9DSN7 | 41-257 | None |
| A0A0G2DV86 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.