DPCstruct | MC64079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7N4P4 | 15-112 | LDFALLLAILQICLVVFLTRMLAFLLSPFRQPRVIVEIIGGVLLGSSFLGRYRAYLHAVFLPKSLSVLDTLANIGLLFFLFLVGLEL… |
| M5C9F6 | 20-141 | AAEQQGGLLNGSDPTEYNTHDPIRLFIIQLGVIMLMTQLLSLFLGRIRQPKVIAEVIGGIILGPTAMGRIPGFTEHIFPEPSRPFLA… |
| A0A820Q034 | 1-92 | None |
| A0A3L6PHQ9 | 12-133 | None |
| A0A376E725 | 35-161 | None |
| A0A2V7V3I9 | 47-143 | None |
| D7TV99 | 8-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.