DPCstruct | MC64073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 210 ± 35 aa |
| Standard deviation of domain lengths | 34.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 54.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XBB4 | 13-210 | SIILIRCVSDSEGQVGENNCSGDHVEASALRKLEGKCFWGKIPINLLGSSLENCVTLNLGHTVELASTVTMNPSFLEPKFLEQDSCL… |
| A0A452XBA3 | 14-200 | EGQVGENNCSGDHVEASALRKLEGKCFWGKIPINLLGSSLENCVTLNLGHTVELASTVTMNPSFLEPKFLEQDSCLTFCSHKVDATG… |
| A0A4D6FTI9 | 95-369 | None |
| A0A453A6F3 | 40-236 | None |
| A0A811NRN0 | 23-302 | None |
| A0A0K9RTZ4 | 174-369 | None |
| A0A452XBA4 | 41-239 | None |
| A0A835R5K0 | 260-437 | None |
| A0A1D6L4S9 | 1-184 | None |
| A0A287GV16 | 169-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.