DPCstruct | MC64069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | CL0044- PF12309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4S1L3 | 3-162 | TVSELNETYYLDVCRELWLELGLICSSIAEIKSLQFSQNSSAHTATKLNNTLQVSLNFLLKYINSFINKRTNKMPDRFPLEYERDAL… |
| A0A2D4JDX1 | 76-243 | DMLEPLYSGLNPQYYLLLCRQLQFELADTYYEMMDLKVAIGNKLEELDSHTVKKINSLAQMAMKFYELFLDSLRNPDKIFPETLEED… |
| A0A1Q9D588 | 67-249 | None |
| A0A814SHD3 | 14-178 | None |
| A0A0G4G4X2 | 677-871 | None |
| A0A0L7KRX7 | 52-227 | None |
| A0A146KXD4 | 433-594 | None |
| A0A6P8QP66 | 292-451 | None |
| U4UHJ4 | 424-589 | None |
| E4Y3E2 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.