DPCstruct | MC64065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RXH5 | 1-102 | MLIPSGKTPEQCPSVVSLLAESYNPHVRYGAAMALGIACAGTGLKEAIALLDPMTNDPVNFVRQGALIASAMILIQHTEQTCPKVKD… |
| R0KMJ6 | 103-196 | QDLLISTLEPLSENHNFFVRSIVCLCLGFFNAGTGNKTCCDIVEALIHDSNNLVRQSACIGMGFLLMQCNPSIIQNYKRILDTINKI… |
| F6H2R6 | 91-184 | None |
| A0A183MXF4 | 739-839 | None |
| A0A4U5NLK1 | 1-71 | None |
| A0A0N4ZZ07 | 16-109 | None |
| A0A6G3MEK2 | 46-139 | None |
| R4XB38 | 606-700 | None |
| A0A540LZW4 | 548-647 | None |
| U7Q0J1 | 739-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.