DPCstruct | MC64064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 224 ± 42 aa |
| Standard deviation of domain lengths | 42.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.11 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | PF05648- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2BSV0 | 10-241 | QESLDKLCRFLSSVRGTDKVLMLYQYVAKILIVKLLARDKNSVLAARLKNLAGPVGDTRILLRYYGLIPLFQWIIFSERNPPSTPFL… |
| A0A7E4RWR7 | 2-188 | FQYSCRTLWYVMKEYQLSSNNSIGKFESLEYHFSTFRKLLRFGRFFENLYHALNTINRPNIIVSTTSTLAHISNAIFLFCDHILWLG… |
| A0A7R9ACJ5 | 12-178 | None |
| A0A1V9YBP7 | 315-570 | None |
| A0A5B8MZP7 | 6-243 | None |
| A0A194XPA5 | 23-305 | None |
| C1E1U6 | 18-264 | None |
| F8NWX5 | 25-284 | None |
| M8C3H6 | 13-237 | None |
| A0A7J8BFS7 | 4-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.