DPCstruct | MC64063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.34 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF15031- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RTY1 | 3-116 | GPKASEVLTAWLRQAKEPSWTSYFVKYSSVVNDQIGMSHFNWQVGTSNYHILRTGCFPYIKYHCTKRPYQDLSIEDTFMGIVKLMNL… |
| A0A5E4MH18 | 12-129 | LPNASVVLTNYLEQSKEPPWTSFFVKYSSVIDDQRGRSHFNWKVGNSNYHVLRSGCFPYIKYHCTKRPYENLEVEDRLFYILKIVNL… |
| A0A2R7W7G0 | 4-128 | None |
| A0A7M4DWU2 | 14-112 | None |
| A0A7R9ED14 | 88-211 | None |
| J9E9J6 | 20-126 | None |
| A0A6J3C197 | 2-91 | None |
| A0A6A4JND5 | 22-133 | None |
| L5K3G4 | 292-413 | None |
| A0A7R9PUI8 | 21-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.