DPCstruct | MC64056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 872 |
|---|---|
| Mean domain length (aa) | 156 ± 31 aa |
| Standard deviation of domain lengths | 31.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 92.47 |
| Assigned Pfam label(s) | PF16046- PF16182- CL0126- PF03763- PF03535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RFD2 | 24-165 | FAVEQNRPYCNPCYLVLFGKKCKRCGELIEKSKTIAALGVHWHLEHFTCESCKTELNQKQFFEKDGMPYCKDCYEKKFCPTCKGCKK… |
| U5CPH3 | 14-174 | ISCTHCGRWISEDEVHYGADHYPYCEECYDKLFINCTYCGETVWKEDAKRTPDDEYICSNCFNEHCVSCTECGKTLYKDEAEYVNNE… |
| A0A5S6Q6Q4 | 2-99 | None |
| A0A6I8VX77 | 68-240 | None |
| A0A397FFE6 | 348-491 | None |
| A0A1V8T0J9 | 608-793 | None |
| A0A7E4WDE1 | 92-196 | None |
| A0A5B8SCW3 | 3-128 | None |
| A0A2I2YL09 | 2-169 | None |
| A0A3Q7SY39 | 117-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.