DPCstruct | MC64055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 145 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RCB6 | 1-158 | MRTAVIGGNTNTYLGAKRDLDPPIWASKIRFYPFSYHRRTVCMRVEIYGCYWNDGIVSYSMPQGDKRGTAWEFFDATYDGHWDAELK… |
| E1JHA2 | 218-370 | LPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGMQRGMDIDLSDKTYDGYEEGDHYVNGLG… |
| A0A7R9J164 | 1-203 | None |
| A0A834U3P9 | 88-213 | None |
| A0A182INL7 | 91-212 | None |
| A0A4Y2BZ53 | 1-125 | None |
| A0A6A4IV99 | 2-158 | None |
| A0A6G0Z7H3 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.