DPCstruct | MC64054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9HEY0 | 1-90 | MAQSTPVNLSNHAFFNLGGKPFGTIHNHILKINADRFTSVDEILIPFGENAFVEGTPFDFRKGNIIGKDLPLQESNEQLKKGKDTAI… |
| A0A838KB30 | 347-416 | NHAYLNLGGDGSGSIEGHELHMAADRFLTVDDAMIPTGEIHQVAGTPMDFRTAKPIGRDLRAGTEQLRHG |
| A0A7X6VHA2 | 19-101 | None |
| A0A7S2GKS5 | 74-166 | None |
| A0A834TE42 | 179-258 | None |
| A0A7J0GAF0 | 93-167 | None |
| A0A6S7D4T7 | 91-187 | None |
| A0A5D3BFQ2 | 187-251 | None |
| A0A814LDY5 | 7-85 | None |
| A0A368VS54 | 449-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.