DPCstruct | MC6405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453SLM0 | 72-149 | EQLAATSPFLEQLCRKKEKRVKEFADVQLQIQTIRGEIAGTLQVGDHLEMPHVNEDDLSMKKLNEFLFELQALQKEKV |
| W1PTE6 | 3-73 | PQLEEMRKRKVDRINQFSDVLGQIQKISREISGSTLHNSSKIIVDESDLSLRKLEEFHNQLQALQKEKSDR |
| A0A287FXV9 | 1-77 | None |
| A0A4S4ED64 | 208-280 | None |
| A0A1J3KAG1 | 24-99 | None |
| I1NMV2 | 10-86 | None |
| A0A445L0W9 | 283-369 | None |
| A0A438IJN8 | 52-140 | None |
| A0A426Y470 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.