DPCstruct | MC64043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A504Z1H5 | 1-66 | MRALLTPEIAPRMGVVLFRPGSELMPLFMQGRVLLEPEPEQFSSFASGVVPAVSQPLADDPAVRDV |
| A0A3R0WJL6 | 1-67 | MRVLLRPVLVPELGMVLLKPGRESMSAFHNGRILVEPEPKNMRGLPSGVVPAVRQPLAEDKTLLPFF |
| I0QPV8 | 2-79 | None |
| A0A376W6V4 | 1-56 | None |
| A0A377AZH2 | 1-87 | None |
| A0A6N8K645 | 1-67 | None |
| A0A376VQG9 | 1-60 | None |
| A0A6D0WA84 | 1-67 | None |
| A0A376P6P1 | 95-153 | None |
| A0A156GHF5 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.