DPCstruct | MC64042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 110 ± 30 aa |
| Standard deviation of domain lengths | 29.76 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 58.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402XCL5 | 9-111 | EVQARAPLDSPELTGTPLTPTPPLIVNNKQIVNAEFVHAAVAALVGASPEALDTLAELAEALGNDPNFATTMLNTLAGKQPLNETLT… |
| A0A719IA10 | 1-90 | MTGTPTAPTPETAAAGIEIATAAFVAAKVAQLVGSAPETLDTLKELADALGNDPNFATTVLNKLAGKQPLDDTLTALSGKSVDGLIE… |
| A0A381GPP5 | 92-192 | None |
| A0A447JDY2 | 3-158 | None |
| A0A485AI38 | 33-153 | None |
| Q8ZNI3 | 31-145 | None |
| A0A2X3K2U1 | 237-381 | None |
| A0A379US00 | 117-227 | None |
| A0A6X8WP47 | 31-139 | None |
| A0A377BD13 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.