DPCstruct | MC6404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 65.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1PRT5 | 1-72 | MKPGILSQKRKEALGMPEGAPPPWLIKMQRYGPPPSYPHLKIPSSNAPIPPGASFAYHPGGWGKPPVVEVSF |
| W1P8T5 | 1-72 | MKPGILSQELKEALGMPEGAPPPWLINMQRYGPPPSYLHLKIPGLNAPIPPGASFGYHPGGWGKPPVDEVSF |
| A0A7S0IXC4 | 60-127 | None |
| A0A3M7LYC0 | 693-761 | None |
| A0A453Q673 | 67-135 | None |
| A0A7J8VJ16 | 323-391 | None |
| A0A4V5NA51 | 605-673 | None |
| A0A444WYF8 | 273-341 | None |
| R1BL73 | 171-246 | None |
| A0A0B2PD90 | 118-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.