DPCstruct | MC64034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 110 ± 27 aa |
| Standard deviation of domain lengths | 26.80 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02748- PF01948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832IL21 | 10-120 | VDSADGIFKSADGSYKGYISLPDRYLSFKEIKKLSAISPNTTVNIIKNSRVVEKYRIKMPPRIYGFEEIRCKNENCITNPAHGENVT… |
| I3B7L2 | 2-73 | LGFVARQATVDVVRGGKIVEKKQPNLPEHIVGVISCVNPRCVTTAEPGIKQMFHLVHSERLEYRCDYCDEEA |
| A0A7J3JW37 | 1-62 | None |
| A0A842WAI2 | 30-154 | None |
| A0A7S3MGS1 | 10-141 | None |
| A0A842ZG69 | 1-84 | None |
| A0A2R6EXE4 | 36-146 | None |
| A0A090SXU8 | 1-86 | None |
| A0A2R6AKV0 | 23-119 | None |
| A0A813JT03 | 729-874 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.