DPCstruct | MC6403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 174 ± 37 aa |
| Standard deviation of domain lengths | 37.33 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 90.37 |
| Assigned Pfam label(s) | PF03747- CL0214- CL0220- CL0021- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1PB18 | 10-159 | LEQLYNRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSKKEFVDGMTELGCDSTEKLKALLPRLEQELKDT… |
| W1PR85 | 12-181 | VDSMAETYTEYQEIISLSDSPGKMKASLAALSANAYSQGLTGITALDGLHRLKLSLESKPFNVQQFSWFYRFVFFMCRVSGQRSMLV… |
| A0A835Y3W2 | 2-106 | None |
| A0A553P5A7 | 611-799 | None |
| A0A1B8F006 | 330-550 | None |
| A0A668RER3 | 403-596 | None |
| A0A0F7S7Q5 | 12-162 | None |
| A0A6P8H489 | 185-372 | None |
| A0A7R8ZZI0 | 695-895 | None |
| A0A6I9YR63 | 43-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.