DPCstruct | MC64026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 25.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353ZC65 | 330-459 | QGTSSKRSLEATPIKAPHSISNLRGSRSGFLGYCPVALADQRELIPSSNEFTSVFAGREYQFSSAEAQQAFEANPRLYVPAVGGQDI… |
| A0A0S8B2I1 | 25-144 | VVGDGDDAELMLRGNDPVAYHTVGKPVKGDPAIKTLHDGLTYRFASESNKKIFVAAPERYVPAFGGYCASGAHYALKARIGADTFKI… |
| A0A518CJP9 | 570-709 | None |
| A0A7S2UVD9 | 50-267 | None |
| A0A7S2UVY3 | 93-221 | None |
| A0A7S2XUP2 | 79-205 | None |
| A0A7S2Y474 | 105-267 | None |
| A0A7S2US34 | 85-291 | None |
| A0A7V4PC67 | 521-665 | None |
| A0A7C2N8C0 | 11-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.