DPCstruct | MC6402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 49.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9E6J4 | 11-113 | LLEDYGFSCHCDRCKVEANWSNEDDGGEDEAMEEDDENMEGSEGENNELEPEGDDDFPHAYFFVRFVCDRENCGGTLAPLPPSNGGP… |
| W1PQC1 | 5-89 | EDYGFVGECDSCMVEKTWKEDDEEEDEEMTLENEEDEQEFPHAYFFMRYLCPSEECGGSMGPLPPSQGTPSNIMECNVCRKLRRE |
| A0A7J8RT35 | 72-190 | None |
| A0A7J0HDB3 | 1-83 | None |
| D8RED9 | 48-155 | None |
| D8RHY0 | 168-275 | None |
| N1QSQ0 | 99-220 | None |
| A0A6A1UND9 | 63-168 | None |
| W1PBF6 | 29-120 | None |
| A0A5P1E0N2 | 48-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.