DPCstruct | MC64018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 137 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.89 |
| Pfam Score | 99.13 |
| Assigned Pfam label(s) | PF01124- PF05821- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523MH56 | 6-126 | YTALVTIAAVVYTFILSGFVSAARAKTGVNAPAMAGQPDFDRVFRIHMNTVEQLVLFIPVLWLATSVVGDLWAAEIGVVWIVGRLTY… |
| A0A6J0SU66 | 2-111 | VSKAYFALQVISVRRKCKITPPLTLGPPEFERIFRAQTNCSEYFPIFISLLWVSGIFSHQVLAAFCGLLYLYARYWYFTGYARSAQE… |
| K8FHW7 | 18-159 | None |
| A0A1W9I0Z8 | 1-128 | None |
| A0A819R6G2 | 358-473 | None |
| A0A812Y2J3 | 307-467 | None |
| A0A7S2KV36 | 5-142 | None |
| A0A835GZ67 | 2-107 | None |
| A0A2G2J3P5 | 92-221 | None |
| A0A7S1XV94 | 75-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.