DPCstruct | MC64013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 342 ± 62 aa |
| Standard deviation of domain lengths | 62.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.88 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0344- PF11870- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830G027 | 30-380 | ILDLAREIRETKLAVLEHLDDYVQKTIRAVERTGGRAYLARDAEEARKIVDDIIGERKRVVFSKSNVAYEVGLREHLVSRGLDAWET… |
| A0A7T9DS26 | 71-375 | AGIKVLWAVDTAQAHTELNAVIDKFQQHKIHIHTCYNELETEKLNQPSPNSIKNKISICDAIFVSAEPAMIACLSDKNFYESDVKII… |
| A0A2V6TKX0 | 38-387 | None |
| A0A7V2ALJ9 | 1-327 | None |
| A0A3E1EB09 | 31-458 | None |
| A0A832B499 | 10-357 | None |
| A0A1C3F4S4 | 16-336 | None |
| A0A354TC76 | 45-462 | None |
| K6P2U4 | 56-498 | None |
| A0A7X3QIZ9 | 2-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.