DPCstruct | MC64010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 203 ± 38 aa |
| Standard deviation of domain lengths | 38.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0023- PF13005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4KYZ5 | 1-172 | MFYLCEHNACVIRQQELDFTDARYICEKTGIWTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIVKDWMKTKGDTGKRKTF… |
| A0A4R8EDV4 | 405-624 | GSTANMPESDIHGQFLQGTQHEFYTRCPGCGNMEPMIRAFPNIVVKQPQGGYRYECQQCHAEITDPQDGEWRARFPERAQGSHPCVS… |
| A0A828FNS1 | 1-114 | None |
| A0A285D3Y8 | 128-354 | None |
| A0A6J4G269 | 18-247 | None |
| A0A1A9VKE5 | 653-844 | None |
| A0A828U7W1 | 1-213 | None |
| A0A830WLI0 | 1-113 | None |
| A0A0F2NJJ8 | 194-426 | None |
| A0A376TF77 | 45-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.