DPCstruct | MC6401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | CL0036- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7FGC7 | 57-221 | VKLAAKIAGIHWWYKTESHAAELTSGYYNLSDRDGYRPVARMFARHNAILNFTCLEMRNSEQPEEAKSCAQELVQQVLSDGWRENLE… |
| W1PHK7 | 388-550 | SAKVGGIHWQYDLKSHPAELTAGYFNTSFRDGYIPIAHMFARHGVSLCCPCFDMSDENAKFFNIHSSPEGFLKQIVFAAKICNIHLT… |
| A0A1P8B7H0 | 250-398 | None |
| A0A7I8K1R5 | 244-385 | None |
| A0A1J6IR07 | 972-1125 | None |
| M7WG24 | 14-124 | None |
| A0A2N9IDF2 | 86-220 | None |
| A0A022QZX8 | 196-337 | None |
| A0A5D2TMC3 | 288-371 | None |
| A0A7C9DFV7 | 36-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.