DPCstruct | MC64005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 29.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.97 |
| Pfam Score | 96.21 |
| Assigned Pfam label(s) | CL0123- CL0229- CL0114- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8N0Z7 | 14-160 | MKEPVSSYTSYPPPLARYEDVVASPKLFLATLEKLHATMGTKFMIPVIGGKELDLHKLFVEVTSRGGIEKIVRERRWKEVTAVFNFP… |
| A0A3P7DPL1 | 72-196 | IDRLVGPVTAMNPQHIMPERRAFFEKLVQFCEQQGEPITQVPQVSKQTVDLHRLYLAVMKRGGFEQVTRDKTWKQVCTEANSEMSES… |
| A0A5K4FB54 | 578-758 | None |
| A0A2G3B4J4 | 7-163 | None |
| G4LUD8 | 12-209 | None |
| A0A5N6PJU3 | 67-269 | None |
| A0A396HZN8 | 9-169 | None |
| A0A5B8MK90 | 50-196 | None |
| A0A3B4DTU9 | 12-167 | None |
| A0A4Y1R0C2 | 7-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.