DPCstruct | MC640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 185 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285TU41 | 129-313 | GASSEGPLACILRNVEVNLVPVFIDVAFAFMVLFGVFMIAKSIYSMAVSHAQGQRGQGANWQGNLILGIILTNLPAFLHTIEETLGV… |
| A0A1G0G2G1 | 2-178 | RVDPTFPELLHNLAVALPAVGKLVAAAMYLAGFVLIFRGLYALKQYGEMRTMMSVNADLKTPIILICIGTVLIFYPTLINTSLSTVY… |
| A0A1J4RH97 | 201-375 | None |
| A0A2S5MFF7 | 11-184 | None |
| A0A1R3L1I0 | 221-417 | None |
| A0A142BW95 | 15-185 | None |
| A0A3M3JU98 | 25-216 | None |
| A0A2D6K2Y3 | 376-573 | None |
| K2CF95 | 22-216 | None |
| A0A2D8M2J2 | 169-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.