DPCstruct | MC64
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF13308- PF07007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6V432 | 2-102 | NGTWKTKYGEFKIWALGHQRLQVEFSGVYEYKTAQGPTANTGEGSGIATIEGDTAIFKPEGAEEECRITLKFTGGKLVVMQTGICGF… |
| A0A1H2B1H1 | 276-400 | YINERWGVELATIKDLNHYNGIYLNDGDYAGASLTILALDNNKVQIKGSAVWGKGRPYGPNIGELDFISEIDDNKIKFEDQLDYFKI… |
| A0A388Q4J2 | 14-124 | None |
| V4Q7C5 | 12-137 | None |
| A0A1L7N802 | 22-148 | None |
| A0A8B4MR54 | 10-118 | None |
| A0A2T5R351 | 34-154 | None |
| H8GLN9 | 5-121 | None |
| A0A0K3A4P7 | 18-136 | None |
| A0A3S4GN29 | 8-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.