DPCstruct | MC63996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C1RI98 | 531-615 | GAQLIGAGWVDVLPRGLSSVYYVFDPHYAARSLGVFSVLREIELAAQLNKEWLYLGFFVPGCPSMSYKANYHPYDLLIGGRWHRW |
| A0A149VFH5 | 5-87 | QLVCVSLVDVMSDGLSAVYTFYDPTTPAASWGTFSILWLLHLAKQRGHLHLYLGYYVPGSQKMAYKATFQPAEIFQGGHWTLL |
| B6K0Y7 | 214-299 | None |
| A0A7C3TLK2 | 173-262 | None |
| A0A2E8X8A1 | 59-159 | None |
| A0A183J8N5 | 39-124 | None |
| E1ZK19 | 49-153 | None |
| A0A4Z1PGY4 | 269-376 | None |
| A0A7C8QJ80 | 143-231 | None |
| A0A072PDD2 | 95-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.