DPCstruct | MC63991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 251 ± 33 aa |
| Standard deviation of domain lengths | 32.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0490 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A149SEE8 | 20-242 | IGHILFLSDSILFTRTDMSGPLLTREHVDFSPRDGHFLRHVLLPTPVTHAQQLMEGLHFARWTGSGLRWMYFLSGVLGAVMFGSGSV… |
| A0A7C7Q6B3 | 147-417 | LINILVLVAAPLLFEGDREAVVAAVYGADPVMKTEQHTFDIEKAMVELQRVASEATPIYLAFHQPGSDKQFLEIAATLPGRLVFSEI… |
| W5Y8C4 | 25-290 | None |
| A0A2G2H3M6 | 2-264 | None |
| A0A1W1IA47 | 215-398 | None |
| F7SXJ7 | 126-385 | None |
| A0A199P186 | 1-222 | None |
| A0A3R8VDL3 | 54-323 | None |
| A0A316MXI0 | 315-596 | None |
| A0A0Q4CAQ3 | 2-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.