DPCstruct | MC6399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9PJ90 | 18-93 | THLTKRRNHLYLALEGLDFVWSLAEVYEFRQMWRKGFSIYDIAEYFQREDVDEVALLVMCQMRKGRIRQRKGGLFG |
| D4G1H4 | 99-171 | DSPVYIPFIEKNFVWNDSEIKRFREMWEANESIICISEELNRDIDEVLFLVMDQASRDFIQPRMNGLLGKDAT |
| A0A2N0F3E8 | 2-83 | None |
| A0A167UZZ6 | 17-104 | None |
| A0A0X8D5S8 | 14-83 | None |
| A0A3B0CVH1 | 2-70 | None |
| A0A2A7WMG3 | 6-74 | None |
| A0A7X8XJ07 | 10-90 | None |
| A0A0D1XTZ2 | 17-94 | None |
| A8U868 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.