DPCstruct | MC63989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0270- PF18324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9PM86 | 1-171 | GIHTVDIYNEKTSSKKVGTKEFAEEVVKRLGQKPNKLKVAEYKSGASPSSKQVTYKIDDSENKTLVGVDIFVDIHAESATQVAKKMN… |
| A0A328YA30 | 198-367 | GIHTYDIFKEGVSKTKVGTKEFAQAVIANLGKVPAQLKPVSYDKNVQIDLPKYEKKPQKNKELVGVDLFVHWNGTDPNELAEILQSI… |
| A0A6A5KZH5 | 312-482 | None |
| A9USI1 | 347-525 | None |
| A0A356KUV1 | 1-148 | None |
| A0A2C9K6Y6 | 231-408 | None |
| A0A812SY35 | 490-664 | None |
| M6T7I0 | 26-202 | None |
| A0A1Q3MV48 | 253-371 | None |
| A0A7Y6JUF4 | 118-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.